Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative tetraspanin-19 (TSPAN19)

This Recombinant Human Putative tetraspanin-19 (TSPAN19) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Putative tetraspanin-19, Tspan-19

UniProt

P0C672

Expression Region

1-248

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRNNKTIIIKYFLNLINGAFLVLGLLFMGFGAWLLLDRNNFLTAFDENNHFIVPISQIL IGMGSSTVLFCLLGYIGIHNEIRWLLIVYAVLITWTFAVQVVLSAFIITKKEEVQQLWHD KIDFVISEYGSKDKPEDITKWTILNALQKTLQCCGQHNYTDWIKNKNKENSGQVPCSCTK STLRKWFCDEPLNATYLEGCENKISAWYNVNVLTLIGINFGLLTSEVFQVSLTVCFFKNI KNIIHAEM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin B1 (V92.1), CF405S conjugate, 0.1mg/mL
BNC040680-100 1x 100 µL

Cyclin B1 (V92.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) activation kit by CRISPRa
GA109602 1 Kit

Human Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) activation kit by CRISPRa

Sign In for Pricing
View Details
LAX1 Human Gene Knockout Kit (CRISPR)
KN418856 1 Kit

LAX1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TROY (TNFRSF19) activation kit by CRISPRa
GA110763 1 Kit

Human TROY (TNFRSF19) activation kit by CRISPRa

Sign In for Pricing
View Details
SuLfatase 2 (SuLF2) (NM_001161841) Human Over-expression Lysate
LC432060 20 µg

SuLfatase 2 (SuLF2) (NM_001161841) Human Over-expression Lysate

Sign In for Pricing
View Details
Gel-BrightTM Imaging Hood
#E90005B 1 Each

Gel-BrightTM Imaging Hood

Sign In for Pricing
View Details