Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Metridium senile Cytochrome c oxidase subunit 2 (COII)

This Recombinant Metridium senile Cytochrome c oxidase subunit 2 (COII) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 2, EC= 1.9.3.1, Cytochrome c oxidase polypeptide II

UniProt

O47496

Expression Region

1-248

Origin

Metridium senile (Brown sea anemone) (Frilled sea anemone)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNLLNNWLIINQFGYDLPEPWQLGLQDAAHPVMEEIIFFHDQVMFILIIIITTVLWLIV KALSGKAYHRYLVDGTLLEIIWTIVPAIILILIAFPSLKLLYLMDEVMDPALTIKAIGHQ WYWSYEYSDYQTETLEFDSYMVPTSELNKGDFRLLEVDNRLVVPINTHVRVLVTGADVLH SFAVPALAVKMDAIPGRLNQTGFFIKRPGIFYGQCSEICGANHSFMPIVIEAVSLDKYIN WVLSGSDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF594 conjugate, 0.1mg/mL
BNC940189-500 1x 500 µL

CD74 (BU45), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL
BNC040806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spastin (Sp 3G11-1), CF568 conjugate, 0.1mg/mL
BNC682844-500 1x 500 µL

Spastin (Sp 3G11-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF740 conjugate, 0.1mg/mL
BNC741828-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-H) (Neuronal Marker) (rNF421), CF647 conjugate, 0.1mg/mL
BNC472348-100 1x 100 µL

Neurofilament (NF-H) (Neuronal Marker) (rNF421), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WT1 (Wilm's Tumor 1) (WT1/857 + 6F-H2), CF594 conjugate, 0.1mg/mL
BNC941138-500 1x 500 µL

WT1 (Wilm's Tumor 1) (WT1/857 + 6F-H2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details