Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vanderwaltozyma polyspora Cytochrome c oxidase subunit 2 (COX2)

This Recombinant Vanderwaltozyma polyspora Cytochrome c oxidase subunit 2 (COX2) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 2, EC= 1.9.3.1, Cytochrome c oxidase polypeptide II

UniProt

A6H4Q5

Expression Region

1-249

Origin

Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYILTNILSIISNDVPTPYALGFQDSATPNQEGILELHDNIMFYLLVILGLVSWMLYTIT KTYSKNPLPYKYMKHGQFIEIIWTIFPAVVLLIIAFPSFILLYLCDEVISPAMTVKVIGY QWYWKYEYSDFVNSNGETVEFESYIIPDDLLEEGQLRLLDTDTSVVVPVDTHIRFIVTAA DVIHDFAIPSLGIKVDANPGRLNQVSALIQREGVFYGMCSELCGTGHSQMPIKIEVVSLG KYLGWLNEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL
BNC041003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL
BNC741820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
BNC040994-500 1x 500 µL

TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF647 conjugate, 0.1mg/mL
BNC470039-500 1x 500 µL

CD34 (ICO-115), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL
BNC040633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), CF488A conjugate, 0.1mg/mL
BNC880531-500 1x 500 µL

VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details