Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Variola virus Protein L1 (L1R)

This Recombinant Variola virus Protein L1 (L1R) spans the amino acid sequence from region 2-250.

Product Specifications

Product Name Alternative

Protein L1, Virion membrane protein M25

UniProt

P33040

Expression Region

2-250

Origin

Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADA DAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAV VDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAG TGVQFYMIVIGVIILAALFMYYAKRMLFTSTNDKIKLILANKENVHWTTYMDTFFRTSPM VIATTDIQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACOX1 Polyclonal Antibody
E-AB-14479-01 20 µL

ACOX1 Polyclonal Antibody

Sign In for Pricing
View Details
ACOX1 Polyclonal Antibody
E-AB-14479-02 60 µL

ACOX1 Polyclonal Antibody

Sign In for Pricing
View Details
ACOX1 Polyclonal Antibody
E-AB-14479-03 120 µL

ACOX1 Polyclonal Antibody

Sign In for Pricing
View Details
ACOX1 Polyclonal Antibody
E-AB-14479-04 200 µL

ACOX1 Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Fallopian tube
CS803982 5x 5 µm

Tissue FFPE Sections, Fallopian tube

Sign In for Pricing
View Details
Frequenin (NCS1) Rabbit Polyclonal Antibody
AP07405PU-N 50 µg

Frequenin (NCS1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details