Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Variola virus Protein L1 (L1R)

This Recombinant Variola virus Protein L1 (L1R) spans the amino acid sequence from region 2-250.

Product Specifications

Product Name Alternative

Protein L1, Virion membrane protein M25

UniProt

P33040

Expression Region

2-250

Origin

Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADA DAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAV VDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAG TGVQFYMIVIGVIILAALFMYYAKRMLFTSTNDKIKLILANKENVHWTTYMDTFFRTSPM VIATTDIQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NT5C1B activation kit by CRISPRa
GA114257 1 Kit

Human NT5C1B activation kit by CRISPRa

Sign In for Pricing
View Details
Cripto1 (TDGF1) (NM_003212) Human Over-expression Lysate
LC401110 20 µg

Cripto1 (TDGF1) (NM_003212) Human Over-expression Lysate

Sign In for Pricing
View Details
XTP3TPA (DCTPP1) (N-term) Rabbit Polyclonal Antibody
AP12472PU-N 400 µL

XTP3TPA (DCTPP1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC44A4 (NM_001178044) Human Over-expression Lysate
LC433412 20 µg

SLC44A4 (NM_001178044) Human Over-expression Lysate

Sign In for Pricing
View Details
TSPYL1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A4]
TA811398AM 100 µL

TSPYL1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A4]

Sign In for Pricing
View Details
SMARCE1 (NM_003079) Human Over-expression Lysate
LY401073 100 µg

SMARCE1 (NM_003079) Human Over-expression Lysate

Sign In for Pricing
View Details