Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein P8B7.13 (SPBP8B7.13)

This Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein P8B7.13 (SPBP8B7.13) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

Putative uncharacterized membrane protein P8B7.13

UniProt

O94262

Expression Region

1-251

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEPKPMQMSVETETVLNVSQVQIPSSCDRKASLETLKTKKNAQKKKKISLPNVMTSKAA MFAARVASAVDQDPNDEESENFVYENLIPTNDDELHSPSASIHSFQTYNLPLEMLPTINH VPYYGSAGTNALNGGPLSNSRKLIPKRSAKFSSMVGSSDTRCNSPTTARGLATSPLQINP TTSKSPLLNKKLSSTSQEPFRTSRRSGQESGDVTTKMLRNLLHKRLWISFFFACFVVLSL VYFHYAVQPLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hoxd13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6722206 1.0 µg DNA

Hoxd13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
GMFG Human qPCR Template Standard (NM_004877)
HK203393 1 Kit

GMFG Human qPCR Template Standard (NM_004877)

Sign In for Pricing
View Details
Lentiviral human SLC10A2 sgRNA gene knockout kit - Lentiviral human SLC10A2 sgRNA gene knockout kit (plasmid)
GTR15399764 1 Vial

Lentiviral human SLC10A2 sgRNA gene knockout kit - Lentiviral human SLC10A2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Ad-mCherry-GFP-LC3B
C3011-1ml 1 mL

Ad-mCherry-GFP-LC3B

Sign In for Pricing
View Details
Ponasterone A
T21205 1 mg

Ponasterone A

Sign In for Pricing
View Details
2-Deoxy-D-Ribose Cell Culture Tested
TC1114-01 1 g

2-Deoxy-D-Ribose Cell Culture Tested

Sign In for Pricing
View Details