Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0545 (MJ0545)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0545 (MJ0545) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0545

UniProt

Q57965

Expression Region

1-251

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGKMKKVIIPLLISLFIFLIPNYALNPEIIVTPEKCLVNNSVYVIFQWRAPYNVEDFNV TVLSDAVVFKNSTLYYAGVAEDAKVFHIFEGEAVTPGNHTINVQMSYIIDGTLIKKKFLL NISILTLPENIYVSYNNTYNRDEENTSLLENITKIFENTTNVTTPNSTNAIINETNITQN KTNISKNIDIGNITKANTTSQEKITQKFNNTSTQTIENVQKDKGNNWLMYGILGLIIGIV FGFVVMYIIKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WWOX 1/4 Antibody FITC-Conjugated
MBS5400252-01 0.1 mg

WWOX 1/4 Antibody FITC-Conjugated

Sign In for Pricing
View Details
WWOX 1/4 Antibody FITC-Conjugated
MBS5400252-02 5x 0.1 mg

WWOX 1/4 Antibody FITC-Conjugated

Sign In for Pricing
View Details
1- (5-Bromo-2-chloropyridin-4-yl) ethanol
OR71036 500 mg

1- (5-Bromo-2-chloropyridin-4-yl) ethanol

Sign In for Pricing
View Details
DDX39A Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
17830061 1.0 µg DNA

DDX39A Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TMCO4 Adenovirus (Rat)
46830056 1.0 mL

TMCO4 Adenovirus (Rat)

Sign In for Pricing
View Details
Starch Maize (Corn) Extra Pure
02558 00500 500 g

Starch Maize (Corn) Extra Pure

Sign In for Pricing
View Details