Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor expression-enhancing protein 2 (REEP2)

This Recombinant Human Receptor expression-enhancing protein 2 (REEP2) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 2

UniProt

Q9BRK0

Expression Region

1-252

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSWIISRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIVLS WFPFYFELKIAFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMR VGKRGLNLAANAAVTAAAKGVLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLL DTIEDLGDDPALSLRSSTNPADSRTEASEDDMGDKAPKRAKPIKKAPKAEPLASKTLKTR PKKKTSGGGDSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Polyclonal BromoTag Antibody [DyLight 350]
NBP3-17999UV 0.1 mL

Sheep Polyclonal BromoTag Antibody [DyLight 350]

Sign In for Pricing
View Details
CIRBP Peptide (AAP40349)
AAP40349-100UG 100 µg

CIRBP Peptide (AAP40349)

Sign In for Pricing
View Details
LIM kinase 2 Rabbit pAb, PE-Cy7 conjugated
orb2873955 100 µL

LIM kinase 2 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
GUCY2D (Guanylate Cyclase 2D, Membrane (Retina-Specific), CORD5, CORD6, CYGD, GUC1A4, GUC2D, LCA, LCA1, RETGC-1, ROS-GC1, retGC) (FITC)
246868-FITC 100 µL

GUCY2D (Guanylate Cyclase 2D, Membrane (Retina-Specific), CORD5, CORD6, CYGD, GUC1A4, GUC2D, LCA, LCA1, RETGC-1, ROS-GC1, retGC) (FITC)

Sign In for Pricing
View Details
Rabbit anti-FAHDl Antibody, Affinity Purified
A305-619A-T 10 µg

Rabbit anti-FAHDl Antibody, Affinity Purified

Sign In for Pricing
View Details
Recombinant Dog IL-6/Interleukin-6 Protein, C-His
orb2831356-01 20 µg

Recombinant Dog IL-6/Interleukin-6 Protein, C-His

Sign In for Pricing
View Details