Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor expression-enhancing protein 2 (REEP2)

This Recombinant Human Receptor expression-enhancing protein 2 (REEP2) spans the amino acid sequence from region 1-252.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 2

UniProt

Q9BRK0

Expression Region

1-252

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSWIISRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIVLS WFPFYFELKIAFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMR VGKRGLNLAANAAVTAAAKGVLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLL DTIEDLGDDPALSLRSSTNPADSRTEASEDDMGDKAPKRAKPIKKAPKAEPLASKTLKTR PKKKTSGGGDSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster E3 Ubiquitin-Protein Ligase Praja-2 (PJA2) ELISA Kit
MBS9946190-01 48 Well

Hamster E3 Ubiquitin-Protein Ligase Praja-2 (PJA2) ELISA Kit

Sign In for Pricing
View Details
Hamster E3 Ubiquitin-Protein Ligase Praja-2 (PJA2) ELISA Kit
MBS9946190-02 96 Well

Hamster E3 Ubiquitin-Protein Ligase Praja-2 (PJA2) ELISA Kit

Sign In for Pricing
View Details
Hamster E3 Ubiquitin-Protein Ligase Praja-2 (PJA2) ELISA Kit
MBS9946190-03 5x 96 Well

Hamster E3 Ubiquitin-Protein Ligase Praja-2 (PJA2) ELISA Kit

Sign In for Pricing
View Details
Hamster E3 Ubiquitin-Protein Ligase Praja-2 (PJA2) ELISA Kit
MBS9946190-04 10x 96 Well

Hamster E3 Ubiquitin-Protein Ligase Praja-2 (PJA2) ELISA Kit

Sign In for Pricing
View Details
MUC16 (Mucin-16, MUC-16, CA-125, Ovarian Cancer-related Tumor Marker CA125, Ovarian Carcinoma Antigen CA125, CA125, FLJ14303) (HRP)
138161 500 µg

MUC16 (Mucin-16, MUC-16, CA-125, Ovarian Cancer-related Tumor Marker CA125, Ovarian Carcinoma Antigen CA125, CA125, FLJ14303) (HRP)

Sign In for Pricing
View Details
Anti-NT5M Antibody Picoband®, Cy3 Conjugate
A12979-1-Cy3 100 µg/Vial

Anti-NT5M Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details