Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2114 (AF_2114)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2114 (AF_2114) spans the amino acid sequence from region 22-274.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2114

UniProt

O28166

Expression Region

22-274

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AELHFQVFIKGYNGTAELGIFGENLSKVETVKNGSIISLPAGNYTLTLFALNKTFVKDLR LDSNKTVTFNLLFTNRTENLSMMRHAIVQPSLEVFEIVLITNSGGENFEGDLAIPLPEHT GLKISDSSLSFLDFSDLNGNLTLKKLIVPANSTGEVSITYRLVKPKLSLSGAENQTVLIF TTLPVTNQSNAAYRGVQQFKGVDYSVYQCKTKCVLEFKVEPEIKIDKTSAFVILTASALI FIYLFTKRGGWEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF770 conjugate, 0.1mg/mL
BNC701052-500 1x 500 µL

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF488A conjugate, 0.1mg/mL
BNC880176-100 1x 100 µL

CD5 (Cris-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
BNC940270-500 1x 500 µL

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF568 conjugate, 0.1mg/mL
BNC682085-500 1x 500 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF405S conjugate, 0.1mg/mL
BNC041461-100 1x 100 µL

CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (rSPN/839), CF594 conjugate, 0.1mg/mL
BNC942220-100 1x 100 µL

CD43 (T-Cell Marker) (rSPN/839), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details