Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Spermatogenesis-associated protein 9 (SPATA9)

This Recombinant Bovine Spermatogenesis-associated protein 9 (SPATA9) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Spermatogenesis-associated protein 9

UniProt

Q3T021

Expression Region

1-253

Origin

Bos taurus (Bovine)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPIKPVGWICGQVLKNFSGRIEGIQKVIMDLIDEFKDEFPTILRLSQSNQKREPMQKPSK IRMAIALAKINRGTLIQGLNSISRSSKSVAKLLQPQLACRLLELRAISHRLLKEVNAPRQ PLYNIQVRKGSLFEIISFPAKTALTSIMCASYAALIYLTVCVNAVLEKIMKIFQEEESIR QNREESENFRNAFSEPVLSEPLFPEGEIKAKPYRSLPEKPDSISDRPKLPANKLSNKIQV LHSVFDQSAEMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SUV39H2 activation kit by CRISPRa
GA112577 1 Kit

Human SUV39H2 activation kit by CRISPRa

Sign In for Pricing
View Details
p53 (TP53) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A6]
TA502924BM 100 µL

p53 (TP53) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A6]

Sign In for Pricing
View Details
Gamma tubuLin complex component 3 (TUBGCP3) (NM_006322) Human Recombinant Protein
TP307395M 100 µg

Gamma tubuLin complex component 3 (TUBGCP3) (NM_006322) Human Recombinant Protein

Sign In for Pricing
View Details
Plant DNA Isolation 96-Well Kit (Magnetic Bead System)
62400 2 Plates

Plant DNA Isolation 96-Well Kit (Magnetic Bead System)

Sign In for Pricing
View Details
VC pUC19 / Msp I Marker (ready-to-use), 50µg
NM2415 50 µg

VC pUC19 / Msp I Marker (ready-to-use), 50µg

Sign In for Pricing
View Details
Human OR5L1 activation kit by CRISPRa
GA116484 1 Kit

Human OR5L1 activation kit by CRISPRa

Sign In for Pricing
View Details