Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Spermatogenesis-associated protein 9 (SPATA9)

This Recombinant Bovine Spermatogenesis-associated protein 9 (SPATA9) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Spermatogenesis-associated protein 9

UniProt

Q3T021

Expression Region

1-253

Origin

Bos taurus (Bovine)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPIKPVGWICGQVLKNFSGRIEGIQKVIMDLIDEFKDEFPTILRLSQSNQKREPMQKPSK IRMAIALAKINRGTLIQGLNSISRSSKSVAKLLQPQLACRLLELRAISHRLLKEVNAPRQ PLYNIQVRKGSLFEIISFPAKTALTSIMCASYAALIYLTVCVNAVLEKIMKIFQEEESIR QNREESENFRNAFSEPVLSEPLFPEGEIKAKPYRSLPEKPDSISDRPKLPANKLSNKIQV LHSVFDQSAEMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSH2 (DNA Mismatch Repair Marker) (MSH2/2622), CF405S conjugate, 0.1mg/mL
BNC042622-100 1x 100 µL

MSH2 (DNA Mismatch Repair Marker) (MSH2/2622), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DiOC2 (3) iodide [3,3-Diethyloxacarbocyanine iodide]
22038-AAT 25 mg

DiOC2 (3) iodide [3,3-Diethyloxacarbocyanine iodide]

Sign In for Pricing
View Details
4-Hydrazinobenzoic Acid Hydrochloride
TRC-H716575-250MG 250 mg

4-Hydrazinobenzoic Acid Hydrochloride

Sign In for Pricing
View Details
Recombinant MEK7 Antibody
RC-6848-01 50 μL

Recombinant MEK7 Antibody

Sign In for Pricing
View Details
Recombinant MEK7 Antibody
RC-6848-02 100 µL

Recombinant MEK7 Antibody

Sign In for Pricing
View Details
Recombinant MEK7 Antibody
RC-6848-03 1 mL

Recombinant MEK7 Antibody

Sign In for Pricing
View Details