Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yqxM (yqxM)

This Recombinant Bacillus subtilis Uncharacterized protein yqxM (yqxM) spans the amino acid sequence from region 1-253.

Product Specifications

Product Name Alternative

Uncharacterized protein yqxM

UniProt

P40949

Expression Region

1-253

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFRLFHNQQKAKTKLKVLLIFQLSVIFSLTAAICLQFSDDTSAAFHDIETFDVSLQTCKD FQHTDKNCHYDKRWDQSDLHISDQTDTKGTVCSPFALFAVLENTGEKLKKSKWKWELHKL ENARKPLKDGNVIEKGFVSNQIGDSLYKIETKKKMKPGIYAFKVYKPAGYPANGSTFEWS EPMRLAKCDEKPTVPKKETKSDVKKENETTQKDIPEKTMKEETSQEAVTKEKETQSDQKE SGEEDEKSNEADQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM178 (TMEM178A) (NM_001167959) Human Over-expression Lysate
LY432547 100 µg

TMEM178 (TMEM178A) (NM_001167959) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PAX9 activation kit by CRISPRa
GA103397 1 Kit

Human PAX9 activation kit by CRISPRa

Sign In for Pricing
View Details
Human SRSF6 activation kit by CRISPRa
GA104376 1 Kit

Human SRSF6 activation kit by CRISPRa

Sign In for Pricing
View Details
OPTC Antibody
KC-3985-01 50 μL

OPTC Antibody

Sign In for Pricing
View Details
OPTC Antibody
KC-3985-02 100 µL

OPTC Antibody

Sign In for Pricing
View Details
OPTC Antibody
KC-3985-03 1 mL

OPTC Antibody

Sign In for Pricing
View Details