Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Receptor expression-enhancing protein 2 (REEP2)

This Recombinant Bovine Receptor expression-enhancing protein 2 (REEP2) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 2

UniProt

Q2KI30

Expression Region

1-254

Origin

Bos taurus (Bovine)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSWIISRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIVLS WFPFYFELKIAFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMR VGKRGLNLAANAAVTAAAKGQGVLSEKLRSFSMQDLTLIRDEDALPLQGPDGRLRASPGS LLDTIEDLGDDPTLSVRSGTNQADPRTEISEDDTGDKAPKRVKPIKKVPKPEPPASKTLK TRPKKKTSAGGDSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DSG1 Recombinant Rabbit Monoclonal Antibody [JB19-46]
ET7107-83 100 µL

DSG1 Recombinant Rabbit Monoclonal Antibody [JB19-46]

Sign In for Pricing
View Details
FITC Anti-Human CD25 Antibody[BC96]
E-AB-F1194C-01 20 Tests

FITC Anti-Human CD25 Antibody[BC96]

Sign In for Pricing
View Details
FITC Anti-Human CD25 Antibody[BC96]
E-AB-F1194C-02 100 Tests

FITC Anti-Human CD25 Antibody[BC96]

Sign In for Pricing
View Details
FITC Anti-Human CD25 Antibody[BC96]
E-AB-F1194C-03 2x 100 Tests

FITC Anti-Human CD25 Antibody[BC96]

Sign In for Pricing
View Details
MX2 (NM_002463) Human Over-expression Lysate
LY419297 100 µg

MX2 (NM_002463) Human Over-expression Lysate

Sign In for Pricing
View Details
AGAP3 Polyclonal Antibody
E-AB-19694-01 20 µL

AGAP3 Polyclonal Antibody

Sign In for Pricing
View Details