Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Receptor expression-enhancing protein 2 (REEP2)

This Recombinant Bovine Receptor expression-enhancing protein 2 (REEP2) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 2

UniProt

Q2KI30

Expression Region

1-254

Origin

Bos taurus (Bovine)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSWIISRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIVLS WFPFYFELKIAFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMR VGKRGLNLAANAAVTAAAKGQGVLSEKLRSFSMQDLTLIRDEDALPLQGPDGRLRASPGS LLDTIEDLGDDPTLSVRSGTNQADPRTEISEDDTGDKAPKRVKPIKKVPKPEPPASKTLK TRPKKKTSAGGDSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KAP1 Antibody
KC-8465-01 50 μL

KAP1 Antibody

Sign In for Pricing
View Details
KAP1 Antibody
KC-8465-02 100 µL

KAP1 Antibody

Sign In for Pricing
View Details
KAP1 Antibody
KC-8465-03 1 mL

KAP1 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS624920 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast, right
CS650594 5x 5 µm

Frozen Tissue Sections, Breast, right

Sign In for Pricing
View Details
MICA (NM_001177519) Human Over-expression Lysate
LY432900 100 µg

MICA (NM_001177519) Human Over-expression Lysate

Sign In for Pricing
View Details