Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Smittium culisetae Cytochrome c oxidase subunit 2 (cox2)

This Recombinant Smittium culisetae Cytochrome c oxidase subunit 2 (cox2) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 2, EC= 1.9.3.1, Cytochrome c oxidase polypeptide II

UniProt

Q3T4C0

Expression Region

1-254

Origin

Smittium culisetae (Gut fungus)

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNIFSFYIINNDAPEPWQICYQDSATKIMSGIDKLTGEIFYYETLLLIIVGWVLISAIIK YTKTELSYKYFNHGTLIEILWTCSPAFILIAISFPSFKLLYLMDSIIDSQITIKVLGHQW YWSYEYSDYLDNSGDSISFDSIMIPTDDLEPGQFRLLEVDNRIVLPIHTHIRFICTSSDV IHSFAVPSLGLKIDALPGRLNGISTYVEREGTFYGQCSELCGVYHFGMPIVIEAVRIEKY LEWLNIHLDNTPSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD104 (UM-A9), CF488A conjugate, 0.1mg/mL
BNC880449-500 1x 500 µL

CD104 (UM-A9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL
BNC400679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
BNC471820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-100 1x 100 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-500 1x 500 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/2478), CF647 conjugate, 0.1mg/mL
BNC472478-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/2478), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details