Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative epimerase lsrE (lsrE)

This Recombinant Putative epimerase lsrE (lsrE) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

Putative epimerase lsrE, EC= 5.1.3.-

UniProt

Q8Z2Y1

Expression Region

1-254

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSQFAGLTREACVALLASYPLSVGILAGQWIALHRYLQQLEALNQPLLHLDLMDGQFCP QFTVGPWAVGQLPQTFIKDVHLMVADQWAAAQACVKAGAHCITLQAEGDIHLHHTLSWLG QQTVPVIDGEMPVIRGISLCPATPLDVIIPILSDVEVIQLLAVNPGYGSKMRSSDLYERV AQLLCLLGDKREGKIIVIDGSLTQDQLPSLIAQGIDRVVSGSALFRDDRLVENTRSWRAM FKVAGDTTFLPSTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin V (ANXA5) (NM_001154) Human Tagged ORF Clone Lentiviral Particle
RC205619L3V 200 µL

Annexin V (ANXA5) (NM_001154) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
AMIGO2, CT (Amphoterin-induced protein 2, AMIGO2, ALI1) (MaxLight 490) discontinued
031838-ML490 100 µL

AMIGO2, CT (Amphoterin-induced protein 2, AMIGO2, ALI1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Human OSM (N-6His) Protein
MBS189627-01 0.05 mg

Human OSM (N-6His) Protein

Sign In for Pricing
View Details
Human OSM (N-6His) Protein
MBS189627-02 5x 0.05 mg

Human OSM (N-6His) Protein

Sign In for Pricing
View Details
EXD2 Knockout HEK293T Polyclonal Cells
ARG4445 1 Million

EXD2 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
Human IL13RA2 knockdown cell line
ABC-KD7286 1 Vial

Human IL13RA2 knockdown cell line

Sign In for Pricing
View Details