Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative epimerase lsrE (lsrE)

This Recombinant Putative epimerase lsrE (lsrE) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

Putative epimerase lsrE, EC= 5.1.3.-

UniProt

Q8Z2Y1

Expression Region

1-254

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSQFAGLTREACVALLASYPLSVGILAGQWIALHRYLQQLEALNQPLLHLDLMDGQFCP QFTVGPWAVGQLPQTFIKDVHLMVADQWAAAQACVKAGAHCITLQAEGDIHLHHTLSWLG QQTVPVIDGEMPVIRGISLCPATPLDVIIPILSDVEVIQLLAVNPGYGSKMRSSDLYERV AQLLCLLGDKREGKIIVIDGSLTQDQLPSLIAQGIDRVVSGSALFRDDRLVENTRSWRAM FKVAGDTTFLPSTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP4K3 Human qPCR Primer Pair (NM_003618)
HP207105 200 Reactions

MAP4K3 Human qPCR Primer Pair (NM_003618)

Sign In for Pricing
View Details
Phospho-ZIP Kinase (Thr265) Rabbit Polyclonal Antibody (Cy7)
orb1079263 100 µL

Phospho-ZIP Kinase (Thr265) Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
ACMSD Peptide
DF16086-BP 1 mg

ACMSD Peptide

Sign In for Pricing
View Details
Olfr554 Mouse shRNA Lentiviral Particle (Locus ID 258322)
TL511200V 500 µL Each

Olfr554 Mouse shRNA Lentiviral Particle (Locus ID 258322)

Sign In for Pricing
View Details
Rabbit Anti-Cul-01/Cul1 Polyclonal Antibody
PAV6402 100 μL

Rabbit Anti-Cul-01/Cul1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-woodchuck IFN-γ mAb (MT247), unconjugated
3101-3-250 250 µg

Anti-woodchuck IFN-γ mAb (MT247), unconjugated

Sign In for Pricing
View Details