Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative epimerase lsrE (lsrE)

This Recombinant Putative epimerase lsrE (lsrE) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

Putative epimerase lsrE, EC= 5.1.3.-

UniProt

Q8Z2Y1

Expression Region

1-254

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSQFAGLTREACVALLASYPLSVGILAGQWIALHRYLQQLEALNQPLLHLDLMDGQFCP QFTVGPWAVGQLPQTFIKDVHLMVADQWAAAQACVKAGAHCITLQAEGDIHLHHTLSWLG QQTVPVIDGEMPVIRGISLCPATPLDVIIPILSDVEVIQLLAVNPGYGSKMRSSDLYERV AQLLCLLGDKREGKIIVIDGSLTQDQLPSLIAQGIDRVVSGSALFRDDRLVENTRSWRAM FKVAGDTTFLPSTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-503-3p miRNA Agomir
CMJ1919-01 5 nmol

Hsa-miR-503-3p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-503-3p miRNA Agomir
CMJ1919-02 10 nmol

Hsa-miR-503-3p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-503-3p miRNA Agomir
CMJ1919-03 20 nmol

Hsa-miR-503-3p miRNA Agomir

Sign In for Pricing
View Details
2200002D01Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3277005 3x 1.0 µg

2200002D01Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
WDR73 (NM_032856) Human Recombinant Protein
TP309040L 1 mg

WDR73 (NM_032856) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit anti-lL18Rl Recombinant Monoclonal Antibody [BLR172J]
A700-172 100 µL (10 Blots)

Rabbit anti-lL18Rl Recombinant Monoclonal Antibody [BLR172J]

Sign In for Pricing
View Details