Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Receptor expression-enhancing protein 3 (Reep3)

This Recombinant Mouse Receptor expression-enhancing protein 3 (Reep3) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 3

UniProt

Q99KK1

Expression Region

1-254

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSWMISRAVVLVFGMLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTLA WFPLYYELKIAFVIWLLSPYTRGASLIYRKFLHPLLSSKEREIDDYIVQAKERGYETMVN FGRQGLNLAAAAAVTAAVKSQGAITERLRSFSMHDLTAIQGDEPVGHRPYQTLPEAKRKG KQATESPAYGIPLKDGSEQTDEEAEGPFSDDEMVTHKALRRSQSMKSVKTIKGRKEVRYG SLKYKVKKRPQVYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Gelsolin/GSN Antibody
NBP2-55565 100 µL

Rabbit Polyclonal Gelsolin/GSN Antibody

Sign In for Pricing
View Details
Listeria Selective Agar Base
M1474-500G 500 g

Listeria Selective Agar Base

Sign In for Pricing
View Details
Mouse Chaperonin Containing TCP1, Subunit 2 (CCT2) ELISA Kit
TRV-0002972 96 Well Plate

Mouse Chaperonin Containing TCP1, Subunit 2 (CCT2) ELISA Kit

Sign In for Pricing
View Details
FGF17 Blocking peptide
orb1441842 500 µg

FGF17 Blocking peptide

Sign In for Pricing
View Details
Anti-African malaria mosquito Rel2 Antibody Fluoro647 Conjugated
DZ41083-Fluoro647 200 µL/Vial

Anti-African malaria mosquito Rel2 Antibody Fluoro647 Conjugated

Sign In for Pricing
View Details
GJA5 sgRNA CRISPR Lentivector (Human) (Target 3)
K0860004 1.0 µg DNA

GJA5 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details