Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Receptor expression-enhancing protein 3 (Reep3)

This Recombinant Mouse Receptor expression-enhancing protein 3 (Reep3) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 3

UniProt

Q99KK1

Expression Region

1-254

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSWMISRAVVLVFGMLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTLA WFPLYYELKIAFVIWLLSPYTRGASLIYRKFLHPLLSSKEREIDDYIVQAKERGYETMVN FGRQGLNLAAAAAVTAAVKSQGAITERLRSFSMHDLTAIQGDEPVGHRPYQTLPEAKRKG KQATESPAYGIPLKDGSEQTDEEAEGPFSDDEMVTHKALRRSQSMKSVKTIKGRKEVRYG SLKYKVKKRPQVYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GEMIN2 Antibody [DyLight 680]
NBP1-77177FR 0.1 mL

Rabbit Polyclonal GEMIN2 Antibody [DyLight 680]

Sign In for Pricing
View Details
FAM53A sgRNA CRISPR Lentivector (Human) (Target 3)
K0724604 1.0 µg DNA

FAM53A sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Yersinia pestis bv. Antiqua ATP synthase subunit a (atpB), partial
MBS7074182 Inquire

Recombinant Yersinia pestis bv. Antiqua ATP synthase subunit a (atpB), partial

Sign In for Pricing
View Details
Rabbit Polyclonal TBX5 Antibody [DyLight 350]
NBP2-99529UV 0.1 mL

Rabbit Polyclonal TBX5 Antibody [DyLight 350]

Sign In for Pricing
View Details
Mouse GATA3 (GATA Binding Protein 3) ELISA Kit
ELK9421-01 48 Tests

Mouse GATA3 (GATA Binding Protein 3) ELISA Kit

Sign In for Pricing
View Details
Mouse GATA3 (GATA Binding Protein 3) ELISA Kit
ELK9421-02 96 Tests

Mouse GATA3 (GATA Binding Protein 3) ELISA Kit

Sign In for Pricing
View Details