Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Spermatogenesis-associated protein 9 (SPATA9)

This Recombinant Human Spermatogenesis-associated protein 9 (SPATA9) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

Spermatogenesis-associated protein 9, Testis development protein NYD-SP16

UniProt

Q9BWV2

Expression Region

1-254

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQKREPAQKTSK IRMAIALAKINRATLIRGLNSISRSSKSVAKLLHPQLACRLLELRDISGRLLREVNAPRQ PLYNIQVRKGSLFEIISFPAKTALTSIIYASYAALIYLAVCVNAVLKKVKNIFQEEESIR QNREESENCRKAFSEPVLSEPMFAEGEIKAKPYRSLPEKPDISDYPKLLANKQSNNIQVL HSVFDQSAEMNEQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAA4 Recombinant Rabbit Monoclonal Antibody [JE47-81]
ET7109-69 100 µL

SAA4 Recombinant Rabbit Monoclonal Antibody [JE47-81]

Sign In for Pricing
View Details
Frataxin Recombinant Rabbit monoclonal Antibody
HA751547 100 µL

Frataxin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Hsp47 Antibody (Serpinh1)
F40219-0.08ML 0.08 mL

Hsp47 Antibody (Serpinh1)

Sign In for Pricing
View Details
Human IL-31 (Interleukin 31) ELISA Kit
E-EL-H5469-01 24 Tests

Human IL-31 (Interleukin 31) ELISA Kit

Sign In for Pricing
View Details
Human IL-31 (Interleukin 31) ELISA Kit
E-EL-H5469-02 48 Tests

Human IL-31 (Interleukin 31) ELISA Kit

Sign In for Pricing
View Details
Human IL-31 (Interleukin 31) ELISA Kit
E-EL-H5469-03 96 Tests

Human IL-31 (Interleukin 31) ELISA Kit

Sign In for Pricing
View Details