Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Spermatogenesis-associated protein 9 (SPATA9)

This Recombinant Human Spermatogenesis-associated protein 9 (SPATA9) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

Spermatogenesis-associated protein 9, Testis development protein NYD-SP16

UniProt

Q9BWV2

Expression Region

1-254

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQKREPAQKTSK IRMAIALAKINRATLIRGLNSISRSSKSVAKLLHPQLACRLLELRDISGRLLREVNAPRQ PLYNIQVRKGSLFEIISFPAKTALTSIIYASYAALIYLAVCVNAVLKKVKNIFQEEESIR QNREESENCRKAFSEPVLSEPMFAEGEIKAKPYRSLPEKPDISDYPKLLANKQSNNIQVL HSVFDQSAEMNEQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ceturegel™ Matrix GFR, Phenol Red-Free, LDEV-Free
40186ES10 10 mL

Ceturegel™ Matrix GFR, Phenol Red-Free, LDEV-Free

Sign In for Pricing
View Details
Mouse Cox8b activation kit by CRISPRa
GA200848 1 Kit

Mouse Cox8b activation kit by CRISPRa

Sign In for Pricing
View Details
3,3'-((2-Hydroxypropane-1,3-diyl)bis(oxy))bis(4-chlorobenzoic acid) Diethyl Ester
TRC-H952720-50MG 50 mg

3,3'-((2-Hydroxypropane-1,3-diyl)bis(oxy))bis(4-chlorobenzoic acid) Diethyl Ester

Sign In for Pricing
View Details
Calnexin (CANX) Human Gene Knockout Kit (CRISPR)
KN400229 1 Kit

Calnexin (CANX) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MTHFR Mouse Monoclonal Antibody [Clone ID: OTI4D2]
CF812633 100 µg

MTHFR Mouse Monoclonal Antibody [Clone ID: OTI4D2]

Sign In for Pricing
View Details
Lactoylglutathione Lyase (CPTC-GLO1-1), CF647 conjugate, 0.1mg/mL
BNC472258-500 1x 500 µL

Lactoylglutathione Lyase (CPTC-GLO1-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details