Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Spermatogenesis-associated protein 9 (SPATA9)

This Recombinant Human Spermatogenesis-associated protein 9 (SPATA9) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

Spermatogenesis-associated protein 9, Testis development protein NYD-SP16

UniProt

Q9BWV2

Expression Region

1-254

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQKREPAQKTSK IRMAIALAKINRATLIRGLNSISRSSKSVAKLLHPQLACRLLELRDISGRLLREVNAPRQ PLYNIQVRKGSLFEIISFPAKTALTSIIYASYAALIYLAVCVNAVLKKVKNIFQEEESIR QNREESENCRKAFSEPVLSEPMFAEGEIKAKPYRSLPEKPDISDYPKLLANKQSNNIQVL HSVFDQSAEMNEQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACP1 Antibody (Biotin)
KB-8135-01 50 μL

ACP1 Antibody (Biotin)

Sign In for Pricing
View Details
ACP1 Antibody (Biotin)
KB-8135-02 100 µL

ACP1 Antibody (Biotin)

Sign In for Pricing
View Details
ACP1 Antibody (Biotin)
KB-8135-03 1 mL

ACP1 Antibody (Biotin)

Sign In for Pricing
View Details
Calbindin 1 (CALB1) (CALB1/3333), CF647 conjugate, 0.1mg/mL
BNC473333-100 1x 100 µL

Calbindin 1 (CALB1) (CALB1/3333), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Rat CLP1/COLEC12 Protein (His Tag)
PKSR030187 100 µg

Recombinant Rat CLP1/COLEC12 Protein (His Tag)

Sign In for Pricing
View Details
YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (YBX1/2430), CF640R conjugate, 0.1mg/mL
BNC402430-100 1x 100 µL

YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (YBX1/2430), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details