Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Emerin (EMD)

This Recombinant Human Emerin (EMD) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

Emerin

UniProt

P50402

Expression Region

1-254

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRLSPPSSSAASSYS FSDLNSTRGDADMYDLPKKEDALLYQSKGYNDDYYEESYFTTRTYGEPESAGPSRAVRQS VTSFPDADAFHHQVHDDDLLSSSEEECKDRERPMYGRDSAYQSITHYRPVSASRSSLDLS YYPTSSSTSFMSSSSSSSSWLTRRAIRPENRAPGAGLGQDRQVPLWGQLLLFLVFVIVLF FIYHFMQAEEGNPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGR3 (NM_004430) Human Recombinant Protein
TP311140L 1 mg

EGR3 (NM_004430) Human Recombinant Protein

Sign In for Pricing
View Details
PCDHA11 Human Gene Knockout Kit (CRISPR)
KN415523 1 Kit

PCDHA11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (rOV-TL12/30), CF770 conjugate, 0.1mg/mL
BNC701841-500 1x 500 µL

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (rOV-TL12/30), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human LOC102723360 activation kit by CRISPRa
GA119529 1 Kit

Human LOC102723360 activation kit by CRISPRa

Sign In for Pricing
View Details
APC Anti-Human CD1a Antibody[OKT-6]
E-AB-F1126E-01 20 Tests

APC Anti-Human CD1a Antibody[OKT-6]

Sign In for Pricing
View Details
APC Anti-Human CD1a Antibody[OKT-6]
E-AB-F1126E-02 100 Tests

APC Anti-Human CD1a Antibody[OKT-6]

Sign In for Pricing
View Details