Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Emerin (EMD)

This Recombinant Human Emerin (EMD) spans the amino acid sequence from region 1-254.

Product Specifications

Product Name Alternative

Emerin

UniProt

P50402

Expression Region

1-254

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRLSPPSSSAASSYS FSDLNSTRGDADMYDLPKKEDALLYQSKGYNDDYYEESYFTTRTYGEPESAGPSRAVRQS VTSFPDADAFHHQVHDDDLLSSSEEECKDRERPMYGRDSAYQSITHYRPVSASRSSLDLS YYPTSSSTSFMSSSSSSSSWLTRRAIRPENRAPGAGLGQDRQVPLWGQLLLFLVFVIVLF FIYHFMQAEEGNPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BCL2 Like Protein 1 (BCL2L1) ELISA Kit
MBS9392826-01 48 Well

Human BCL2 Like Protein 1 (BCL2L1) ELISA Kit

Sign In for Pricing
View Details
Human BCL2 Like Protein 1 (BCL2L1) ELISA Kit
MBS9392826-02 96 Well

Human BCL2 Like Protein 1 (BCL2L1) ELISA Kit

Sign In for Pricing
View Details
Human BCL2 Like Protein 1 (BCL2L1) ELISA Kit
MBS9392826-03 5x 96 Well

Human BCL2 Like Protein 1 (BCL2L1) ELISA Kit

Sign In for Pricing
View Details
Human BCL2 Like Protein 1 (BCL2L1) ELISA Kit
MBS9392826-04 10x 96 Well

Human BCL2 Like Protein 1 (BCL2L1) ELISA Kit

Sign In for Pricing
View Details
Goat Mouse IgG2b (subclass specific), conjugated with Biotin Antibody
orb21338 1 mL

Goat Mouse IgG2b (subclass specific), conjugated with Biotin Antibody

Sign In for Pricing
View Details
ATL3 Antibody (Biotin)
orb351188-01 50 µg

ATL3 Antibody (Biotin)

Sign In for Pricing
View Details