Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb2261 (Mb2261)

This Recombinant Uncharacterized protein Mb2261 (Mb2261) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb2261

UniProt

P64958

Expression Region

1-255

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLPAANVIMQLAVPGVGYGVLESPVDSGNVYKHPFKRARTTGTYLAVATIGTESDRALI RGAVDVAHRQVRSTASSPVSYNAFDPKLQLWVAACLYRYFVDQHEFLYGPLEDATADAVY QDAKRLGTTLQVPEGMWPPDRVAFDEYWKRSLDGLQIDAPVREHLRGVASVAFLPWPLRA VAGPFNLFATTGFLAPEFRAMMQLEWSQAQQRRFEWLLSVLRLADRLIPHRAWIFVYQLY LWDMRFRARHGRRIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anhuienside F
MBS5824757 Inquire

Anhuienside F

Sign In for Pricing
View Details
TCP1P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV750288 1.0 µg DNA

TCP1P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
CLNS1A Human shRNA Plasmid Kit (Locus ID 1207)
TR313848 1 Kit

CLNS1A Human shRNA Plasmid Kit (Locus ID 1207)

Sign In for Pricing
View Details
Human PPFIA1 Pre-designed siRNA Set B
SI012614B 1 Each

Human PPFIA1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit Anti TREM2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,IHC,Immunofluorescence)
IRBAMLTREM2AP773200UL 1 Each

Rabbit Anti TREM2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,IHC,Immunofluorescence)

Sign In for Pricing
View Details
Lentiviral human XRN2 shRNA (UAS) - Lentiviral human XRN2 shRNA (UAS, iRFP) (100)
GTR15329142 1 Vial

Lentiviral human XRN2 shRNA (UAS) - Lentiviral human XRN2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details