Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb2261 (Mb2261)

This Recombinant Uncharacterized protein Mb2261 (Mb2261) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb2261

UniProt

P64958

Expression Region

1-255

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLPAANVIMQLAVPGVGYGVLESPVDSGNVYKHPFKRARTTGTYLAVATIGTESDRALI RGAVDVAHRQVRSTASSPVSYNAFDPKLQLWVAACLYRYFVDQHEFLYGPLEDATADAVY QDAKRLGTTLQVPEGMWPPDRVAFDEYWKRSLDGLQIDAPVREHLRGVASVAFLPWPLRA VAGPFNLFATTGFLAPEFRAMMQLEWSQAQQRRFEWLLSVLRLADRLIPHRAWIFVYQLY LWDMRFRARHGRRIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Podoplanin (PDPN) ELISA kit
CSB-EL017739HU-01 96 Tests

Human Podoplanin (PDPN) ELISA kit

Sign In for Pricing
View Details
Human Podoplanin (PDPN) ELISA kit
CSB-EL017739HU-02 5x 96 Tests

Human Podoplanin (PDPN) ELISA kit

Sign In for Pricing
View Details
Human Podoplanin (PDPN) ELISA kit
CSB-EL017739HU-03 10x 96 Tests

Human Podoplanin (PDPN) ELISA kit

Sign In for Pricing
View Details
Duck Immune Receptor Expressed On Myeloid Cells 1 ELISA Kit
MBS107255 Inquire

Duck Immune Receptor Expressed On Myeloid Cells 1 ELISA Kit

Sign In for Pricing
View Details
TUBB3 antibody - C-terminal region (ARP63784_P050)
ARP63784_P050 100 µL

TUBB3 antibody - C-terminal region (ARP63784_P050)

Sign In for Pricing
View Details
ZFY19 Rabbit Polyclonal Antibody (PE-Cy7)
orb959352 100 µL

ZFY19 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details