Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb2261 (Mb2261)

This Recombinant Uncharacterized protein Mb2261 (Mb2261) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb2261

UniProt

P64958

Expression Region

1-255

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLPAANVIMQLAVPGVGYGVLESPVDSGNVYKHPFKRARTTGTYLAVATIGTESDRALI RGAVDVAHRQVRSTASSPVSYNAFDPKLQLWVAACLYRYFVDQHEFLYGPLEDATADAVY QDAKRLGTTLQVPEGMWPPDRVAFDEYWKRSLDGLQIDAPVREHLRGVASVAFLPWPLRA VAGPFNLFATTGFLAPEFRAMMQLEWSQAQQRRFEWLLSVLRLADRLIPHRAWIFVYQLY LWDMRFRARHGRRIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XPR1 Protein Vector (Human) (pPB-N-His)
PV046602 500 ng

XPR1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
FHOD1 shRNA (m) Lentiviral Particles
sc-155893-V 200 µL

FHOD1 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
IL-4R Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-41425R-BF405 100 µL

IL-4R Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal FXR2 Antibody (1G2) [HRP]
NB300-259H 0.1 mL

Mouse Monoclonal FXR2 Antibody (1G2) [HRP]

Sign In for Pricing
View Details
Anti-D4 GDI Antibody
39371 100 µL

Anti-D4 GDI Antibody

Sign In for Pricing
View Details
Recombinant human RNASE3 protein
ATGP1809-100 100 µg

Recombinant human RNASE3 protein

Sign In for Pricing
View Details