Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Rv2237/MT2296 (Rv2237, MT2296)

This Recombinant Uncharacterized protein Rv2237/MT2296 (Rv2237, MT2296) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Uncharacterized protein Rv2237/MT2296

UniProt

P64957

Expression Region

1-255

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLPAANVIMQLAVPGVGYGVLESPVDSGNVYKHPFKRARTTGTYLAVATIGTESDRALI RGAVDVAHRQVRSTASSPVSYNAFDPKLQLWVAACLYRYFVDQHEFLYGPLEDATADAVY QDAKRLGTTLQVPEGMWPPDRVAFDEYWKRSLDGLQIDAPVREHLRGVASVAFLPWPLRA VAGPFNLFATTGFLAPEFRAMMQLEWSQAQQRRFEWLLSVLRLADRLIPHRAWIFVYQLY LWDMRFRARHGRRIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Bromomethyl-2-fluorobenzonitrile
161843 1 g

5-Bromomethyl-2-fluorobenzonitrile

Sign In for Pricing
View Details
C12orf43 3'UTR Lenti-reporter-Luc Vector
13755081 1.0 µg

C12orf43 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
SPRR1A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
45382111 3x 1.0 µg

SPRR1A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
ANGPTL5 (Angiopoietin-related Protein 5, Angiopoietin-like Protein 5, UNQ5795/PRO19600) (HRP)
123323-HRP 100 µL

ANGPTL5 (Angiopoietin-related Protein 5, Angiopoietin-like Protein 5, UNQ5795/PRO19600) (HRP)

Sign In for Pricing
View Details
CALB1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
14919061 1.0 µg DNA

CALB1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ELAVL4 (NM_001144776) Human Tagged Lenti ORF Clone
RC226936L4 10 µg

ELAVL4 (NM_001144776) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details