Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Rv2237/MT2296 (Rv2237, MT2296)

This Recombinant Uncharacterized protein Rv2237/MT2296 (Rv2237, MT2296) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Uncharacterized protein Rv2237/MT2296

UniProt

P64957

Expression Region

1-255

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLPAANVIMQLAVPGVGYGVLESPVDSGNVYKHPFKRARTTGTYLAVATIGTESDRALI RGAVDVAHRQVRSTASSPVSYNAFDPKLQLWVAACLYRYFVDQHEFLYGPLEDATADAVY QDAKRLGTTLQVPEGMWPPDRVAFDEYWKRSLDGLQIDAPVREHLRGVASVAFLPWPLRA VAGPFNLFATTGFLAPEFRAMMQLEWSQAQQRRFEWLLSVLRLADRLIPHRAWIFVYQLY LWDMRFRARHGRRIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Paraoxonase 1 (PON1) Protein
abx068422-01 10 µg

Mouse Paraoxonase 1 (PON1) Protein

Sign In for Pricing
View Details
Mouse Paraoxonase 1 (PON1) Protein
abx068422-02 50 µg

Mouse Paraoxonase 1 (PON1) Protein

Sign In for Pricing
View Details
Mouse Paraoxonase 1 (PON1) Protein
abx068422-03 100 µg

Mouse Paraoxonase 1 (PON1) Protein

Sign In for Pricing
View Details
Mouse Paraoxonase 1 (PON1) Protein
abx068422-04 200 µg

Mouse Paraoxonase 1 (PON1) Protein

Sign In for Pricing
View Details
Mouse Paraoxonase 1 (PON1) Protein
abx068422-05 500 µg

Mouse Paraoxonase 1 (PON1) Protein

Sign In for Pricing
View Details
Pacific Blue Mouse IgG2a isotype Control
MBS9472546-01 25 Tests

Pacific Blue Mouse IgG2a isotype Control

Sign In for Pricing
View Details