Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Rv2237/MT2296 (Rv2237, MT2296)

This Recombinant Uncharacterized protein Rv2237/MT2296 (Rv2237, MT2296) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Uncharacterized protein Rv2237/MT2296

UniProt

P64957

Expression Region

1-255

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLPAANVIMQLAVPGVGYGVLESPVDSGNVYKHPFKRARTTGTYLAVATIGTESDRALI RGAVDVAHRQVRSTASSPVSYNAFDPKLQLWVAACLYRYFVDQHEFLYGPLEDATADAVY QDAKRLGTTLQVPEGMWPPDRVAFDEYWKRSLDGLQIDAPVREHLRGVASVAFLPWPLRA VAGPFNLFATTGFLAPEFRAMMQLEWSQAQQRRFEWLLSVLRLADRLIPHRAWIFVYQLY LWDMRFRARHGRRIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG1 Fc Allophycocyanin MAb (Clone 97924)
FAB110A 25 Tests

Human IgG1 Fc Allophycocyanin MAb (Clone 97924)

Sign In for Pricing
View Details
ZNF292 sgRNA CRISPR Lentivector (Human) (Target 1)
K2697702 1.0 µg DNA

ZNF292 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
KCNE1 (Potassium Voltage-gated Channel Subfamily E Member 1, Delayed Rectifier Potassium Channel Subunit IsK, IKs Producing Slow Voltage-gated Potassium Channel Subunit beta Mink, ISK, Minimal Potassium Channel, FLJ18426, FLJ38123, FLJ94103, MGC33114) (Biotin)
128737-Biotin 100 µL

KCNE1 (Potassium Voltage-gated Channel Subfamily E Member 1, Delayed Rectifier Potassium Channel Subunit IsK, IKs Producing Slow Voltage-gated Potassium Channel Subunit beta Mink, ISK, Minimal Potassium Channel, FLJ18426, FLJ38123, FLJ94103, MGC33114) (Biotin)

Sign In for Pricing
View Details
Porcine Luteinizing Hormone (LH) ELISA Kit
EK15233 48 Tests

Porcine Luteinizing Hormone (LH) ELISA Kit

Sign In for Pricing
View Details
Fibronectin (FN, Cold-insoluble Globulin) (MaxLight 550)
MBS6476417-01 0.1 mL

Fibronectin (FN, Cold-insoluble Globulin) (MaxLight 550)

Sign In for Pricing
View Details
Fibronectin (FN, Cold-insoluble Globulin) (MaxLight 550)
MBS6476417-02 5x 0.1 mL

Fibronectin (FN, Cold-insoluble Globulin) (MaxLight 550)

Sign In for Pricing
View Details