Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor expression-enhancing protein 3 (REEP3)

This Recombinant Human Receptor expression-enhancing protein 3 (REEP3) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 3

UniProt

Q6NUK4

Expression Region

1-255

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSWMISRAVVLVFGMLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTVA WFPLYYELKIAFVIWLLSPYTKGASLIYRKFLHPLLSSKEREIDDYIVQAKERGYETMVN FGRQGLNLAATAAVTAAVKSQGAITERLRSFSMHDLTTIQGDEPVGQRPYQPLPEAKKKS KPAPSESAGYGIPLKDGDEKTDEEAEGPYSDNEMLTHKGLRRSQSMKSVKTTKGRKEVRY GSLKYKVKKRPQVYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF2 Protein Vector (Human) (pPM-C-HA)
18986021 500 ng

EEF2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
TDP-43/TARDB Rabbit pAb
E45R17469N-50 50 µL

TDP-43/TARDB Rabbit pAb

Sign In for Pricing
View Details
Diethylene Glycol Monopentyl Ether
TRC-D446313-100MG 100 mg

Diethylene Glycol Monopentyl Ether

Sign In for Pricing
View Details
CASC3, CT (Cancer Susceptibility Candidate Gene 3 Protein Homolog, Metastatic Lymph Node Protein 51 Homolog, Protein MLN 51 Homolog, Protein Barentsz, Btz, mBtz, Protein CASC3, Mln51) (FITC) discontinued
C2081-30A-FITC 200 µL

CASC3, CT (Cancer Susceptibility Candidate Gene 3 Protein Homolog, Metastatic Lymph Node Protein 51 Homolog, Protein MLN 51 Homolog, Protein Barentsz, Btz, mBtz, Protein CASC3, Mln51) (FITC) discontinued

Sign In for Pricing
View Details
PF-04957325 5mg
A21246-5 5 mg

PF-04957325 5mg

Sign In for Pricing
View Details
PLSCR2 Protein Vector (Mouse) (pPM-C-HA)
PV217316 500 ng

PLSCR2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details