Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor expression-enhancing protein 3 (REEP3)

This Recombinant Human Receptor expression-enhancing protein 3 (REEP3) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 3

UniProt

Q6NUK4

Expression Region

1-255

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSWMISRAVVLVFGMLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTVA WFPLYYELKIAFVIWLLSPYTKGASLIYRKFLHPLLSSKEREIDDYIVQAKERGYETMVN FGRQGLNLAATAAVTAAVKSQGAITERLRSFSMHDLTTIQGDEPVGQRPYQPLPEAKKKS KPAPSESAGYGIPLKDGDEKTDEEAEGPYSDNEMLTHKGLRRSQSMKSVKTTKGRKEVRY GSLKYKVKKRPQVYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Niemann-Pick type C2 Antibody (031) [mFluor Violet 500 SE]
NBP2-90211MFV500 0.1 mL

Rabbit Monoclonal Niemann-Pick type C2 Antibody (031) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Mouse Anti-Pneumococcal Type 9V Polysaccharide MAb
PA2023-01 100 μL

Mouse Anti-Pneumococcal Type 9V Polysaccharide MAb

Sign In for Pricing
View Details
Mouse Anti-Pneumococcal Type 9V Polysaccharide MAb
PA2023-02 500 μL

Mouse Anti-Pneumococcal Type 9V Polysaccharide MAb

Sign In for Pricing
View Details
Apolipoprotein C1 (APOC1) Human ELISA Kit
B6082 96 Tests

Apolipoprotein C1 (APOC1) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Human IL22, GST-tagged
IL22-14185H 25 µg

Recombinant Human IL22, GST-tagged

Sign In for Pricing
View Details
6,7-Dihydro-2H-cyclopenta[c]pyridazin-3 (5H) -one
M28553-01 1 g

6,7-Dihydro-2H-cyclopenta[c]pyridazin-3 (5H) -one

Sign In for Pricing
View Details