Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor expression-enhancing protein 3 (REEP3)

This Recombinant Human Receptor expression-enhancing protein 3 (REEP3) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 3

UniProt

Q6NUK4

Expression Region

1-255

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSWMISRAVVLVFGMLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTVA WFPLYYELKIAFVIWLLSPYTKGASLIYRKFLHPLLSSKEREIDDYIVQAKERGYETMVN FGRQGLNLAATAAVTAAVKSQGAITERLRSFSMHDLTTIQGDEPVGQRPYQPLPEAKKKS KPAPSESAGYGIPLKDGDEKTDEEAEGPYSDNEMLTHKGLRRSQSMKSVKTTKGRKEVRY GSLKYKVKKRPQVYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigeon Protein Kinase Inhibitor Beta ELISA Kit
MBS052671 Inquire

Pigeon Protein Kinase Inhibitor Beta ELISA Kit

Sign In for Pricing
View Details
AKR1C1 (NM_001353) Human Over-expression Lysate
LS001645 100 µg

AKR1C1 (NM_001353) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Human Bcl2 Antibody (SAA1989)
HY131023-01 50 µg

Anti-Human Bcl2 Antibody (SAA1989)

Sign In for Pricing
View Details
Anti-Human Bcl2 Antibody (SAA1989)
HY131023-02 100 µg

Anti-Human Bcl2 Antibody (SAA1989)

Sign In for Pricing
View Details
Anti-Human Bcl2 Antibody (SAA1989)
HY131023-03 1 mg

Anti-Human Bcl2 Antibody (SAA1989)

Sign In for Pricing
View Details
4-Methoxytrityl chloride 99+%
233328-01 5 g

4-Methoxytrityl chloride 99+%

Sign In for Pricing
View Details