Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein BEAN1 (Bean1)

This Recombinant Mouse Protein BEAN1 (Bean1) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Protein BEAN1, Brain-expressed protein associating with Nedd4, BEAN

UniProt

Q9EQG5

Expression Region

1-255

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFKRPCPLARYNRTSYFYPTTFSESSEHSHLLVSPVLVASAVIGVVITLSCITIIVGSI RRDRQARIQRHHHRHRRHHHHHRHRRRRHREYASGGHTHSRSSPRMPYACSPAEDWPPPL DVSSEGDVDVTVLWELYPDSPPGYEECMGPGATQLYVPTDAPPPYSMTDSCPRLNGALDS DSGQSRSHRQQEQRTQGQSRLHTVSMDTLPPYEAVCGTGSPSDLLPLPGPEPWPSNSQGS PIPTQAPMPSPERIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1140 3'UTR GFP Stable Cell Line
TU164662 1.0 mL

Olfr1140 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human Anti Neisseria Gonorrhea ELISA Kit
MBS3803564-01 48 Well

Human Anti Neisseria Gonorrhea ELISA Kit

Sign In for Pricing
View Details
Human Anti Neisseria Gonorrhea ELISA Kit
MBS3803564-02 96 Well

Human Anti Neisseria Gonorrhea ELISA Kit

Sign In for Pricing
View Details
Human Anti Neisseria Gonorrhea ELISA Kit
MBS3803564-03 5x 96 Well

Human Anti Neisseria Gonorrhea ELISA Kit

Sign In for Pricing
View Details
Human Anti Neisseria Gonorrhea ELISA Kit
MBS3803564-04 10x 96 Well

Human Anti Neisseria Gonorrhea ELISA Kit

Sign In for Pricing
View Details
Chicken Ubiquitin (Ub) ELISA Kit
MBS4503176-01 48 Tests

Chicken Ubiquitin (Ub) ELISA Kit

Sign In for Pricing
View Details