Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein BEAN1 (Bean1)

This Recombinant Mouse Protein BEAN1 (Bean1) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Protein BEAN1, Brain-expressed protein associating with Nedd4, BEAN

UniProt

Q9EQG5

Expression Region

1-255

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFKRPCPLARYNRTSYFYPTTFSESSEHSHLLVSPVLVASAVIGVVITLSCITIIVGSI RRDRQARIQRHHHRHRRHHHHHRHRRRRHREYASGGHTHSRSSPRMPYACSPAEDWPPPL DVSSEGDVDVTVLWELYPDSPPGYEECMGPGATQLYVPTDAPPPYSMTDSCPRLNGALDS DSGQSRSHRQQEQRTQGQSRLHTVSMDTLPPYEAVCGTGSPSDLLPLPGPEPWPSNSQGS PIPTQAPMPSPERIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (MaxLight 650)
MBS6226863-01 0.1 mL

CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (MaxLight 650)

Sign In for Pricing
View Details
CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (MaxLight 650)
MBS6226863-02 5x 0.1 mL

CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50) (MaxLight 650)

Sign In for Pricing
View Details
Lentiviral mouse Ikbkb shRNA (UAS) - Lentiviral mouse Ikbkb shRNA (UAS, GFP) plasmid
GTR15242386 1 Vial

Lentiviral mouse Ikbkb shRNA (UAS) - Lentiviral mouse Ikbkb shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Phospho-AR/Androgen receptor (Ser94) Rabbit Polyclonal Antibody (Cy5)
orb920449 100 µL

Phospho-AR/Androgen receptor (Ser94) Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Anti-CCL21 Rabbit Monoclonal Antibody
MA1671-.1 100 µL

Anti-CCL21 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human RBP3 Pre-designed siRNA Set A
SI013537A 1 Each

Human RBP3 Pre-designed siRNA Set A

Sign In for Pricing
View Details