Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein P22H7.04 (pi027, SPBP22H7.04)

This Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein P22H7.04 (pi027, SPBP22H7.04) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein P22H7.04

UniProt

Q9C0W3

Expression Region

1-255

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSMLIFNIRVARHKALLSRIVSTNMFNPMFRSLRPIQKSFSEISILRVFNKPPIKKFHNS NILKDITSKRNATPAKIAWQAMTTREPFLVYQAKADKKISLIYLLTVGMLINVCVITSFA SVDIYRAKDEIFANWVDMDYYEKLSYIGSAFITPALYFTLTLILFLPRRNIYSISTLPSQ RFEIVTGFLSPFNKLYFSKSLIVPRKDVSIVTYSLQKNPITLKIRDRPFYYLLNANGKYA GNSKDVLFCVIGNRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL
BNC681050-100 1x 100 µL

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF647 conjugate, 0.1mg/mL
BNC470345-100 1x 100 µL

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF488A conjugate, 0.1mg/mL
BNC880851-100 1x 100 µL

HSP60 (LK1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF568 conjugate, 0.1mg/mL
BNC681052-500 1x 500 µL

CD3e (B-B12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (ENO2/1462), CF640R conjugate, 0.1mg/mL
BNC401462-500 1x 500 µL

NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (ENO2/1462), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), CF405S conjugate, 0.1mg/mL
BNC042345-100 1x 100 µL

CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details