Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Equine herpesvirus 4 Envelope glycoprotein E (gE)

This Recombinant Equine herpesvirus 4 Envelope glycoprotein E (gE) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Envelope glycoprotein E, gE

UniProt

P18345

Expression Region

1-255

Origin

Equine herpesvirus 4 (strain 1942) (EHV-4) (Equine rhinopneumonitis virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GSTWPSRCHSTLLGDRPHFIQPAPNRVDLLFKDIPESATGLYVFVLLYNGHPEAWTYTLL STANHFMNVLTDRTRPRLGEHFYTDHGHQLFTPHPSEATTQELGAWTRHYLAFLLIIICT CAALLIALVVWGCILYIRSNRKPYEVLNPFETVYTSVPSNDPTDEVLVFERLASDSDDSF DSSSDEELELPQPPPAAQLQPYSSLESADASRGRSGFKVWFRDTPEASPEPLHRPTPPVG PDYSKVASKLRSILK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human anti-SARS-CoV-2/COVID-19 S2 Monoclonal Antibody
E40MAV140 50 µg

Recombinant Human anti-SARS-CoV-2/COVID-19 S2 Monoclonal Antibody

Sign In for Pricing
View Details
BAD (Phospho-Ser32) Rabbit pAb
MBS8554188-01 0.1 mL

BAD (Phospho-Ser32) Rabbit pAb

Sign In for Pricing
View Details
BAD (Phospho-Ser32) Rabbit pAb
MBS8554188-02 0.1 mL (AF405L)

BAD (Phospho-Ser32) Rabbit pAb

Sign In for Pricing
View Details
BAD (Phospho-Ser32) Rabbit pAb
MBS8554188-03 0.1 mL (AF405S)

BAD (Phospho-Ser32) Rabbit pAb

Sign In for Pricing
View Details
BAD (Phospho-Ser32) Rabbit pAb
MBS8554188-04 0.1 mL (AF610)

BAD (Phospho-Ser32) Rabbit pAb

Sign In for Pricing
View Details
BAD (Phospho-Ser32) Rabbit pAb
MBS8554188-05 0.1 mL (AF635)

BAD (Phospho-Ser32) Rabbit pAb

Sign In for Pricing
View Details