Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium sp. Nodulation protein nolT (nolT)

This Recombinant Rhizobium sp. Nodulation protein nolT (nolT) spans the amino acid sequence from region 34-289.

Product Specifications

Product Name Alternative

Nodulation protein nolT

UniProt

P55714

Expression Region

34-289

Origin

Rhizobium sp. (strain NGR234)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CKVDLYTQLQEREANEMLALLMDSGVDAVRVAGKDGTSTIQVDEKLLAFSIKLLNAKGLP RQSFKNLGEIFQGSGLIASPTEERARYVYALSEELSHTISDIDGVFSARVHVVLPHNDLL RAGDTPSSASVFIRHDAKTNLPALLPKIKMLVAESIEGLAYDKVEVVLVPVERSAQEQRS LLATDLAQASRPIPEPLLAVAVGVSAAVFAVTCYLLFIVLGHRRRQLTGELSRVQERPGV SALAAIRKKIPGLGRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL
BNC880253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL
BNC740177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL
BNC400965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF568 conjugate, 0.1mg/mL
BNC681035-100 1x 100 µL

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
BNC880218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD1 / PDCD1 / CD279 (PDCD1/922), CF740 conjugate, 0.1mg/mL
BNC740922-500 1x 500 µL

PD1 / PDCD1 / CD279 (PDCD1/922), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details