Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C12orf28 (C12orf28)

This Recombinant Human Uncharacterized protein C12orf28 (C12orf28) spans the amino acid sequence from region 20-275.

Product Specifications

Product Name Alternative

Uncharacterized protein C12orf28

UniProt

Q96LU7

Expression Region

20-275

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DRRVPNLPPSNITSSQEPALLPTASSSAPNTSLVTTPASLQVPEITFCEILPCQETYCCP IRGMKEVSSSPVQRQSEEKEFHQRRWSEDKSKSVLARNALSGPDWESDWIDTTISSIQIM EIQQIIDHQYCIQSLQCGSGNYNYNIPVNKHTPTNVKFSLEINTTEPLIVFQCKFTLGNI CFHSKRGTKGMESHREISQEMTQGYQHIWSLPVAPFSDSMFHFRVAAPDLADCSTDPYFA GIFFTDYFFYFYRRCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam204a 3'UTR Luciferase Stable Cell Line
TU204346 1.0 mL

Fam204a 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Osbpl3 3'UTR GFP Stable Cell Line
TU265662 1.0 mL

Osbpl3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RNF122 Protein Vector (Mouse) (pPB-C-His)
PV224594 500 ng

RNF122 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
OCT-4 discontinued
326631 100 µL

OCT-4 discontinued

Sign In for Pricing
View Details
PI3KCG, CT (PIK3CG, Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform, Phosphatidylinositol 4,5-bisphosphate 3-kinase 110kD catalytic subunit gamma, Phosphoinositide-3-kinase catalytic gamma polypeptide, Serine/threonine protein kinase PIK3CG, p120-PI3K) (FITC) discontinued
039997-FITC 200 µL

PI3KCG, CT (PIK3CG, Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform, Phosphatidylinositol 4,5-bisphosphate 3-kinase 110kD catalytic subunit gamma, Phosphoinositide-3-kinase catalytic gamma polypeptide, Serine/threonine protein kinase PIK3CG, p120-PI3K) (FITC) discontinued

Sign In for Pricing
View Details
Rabbit Monoclonal SATB2 Antibody (rSATB2/6929) [Alexa Fluor 405]
NBP3-14288AF405 0.1 mL

Rabbit Monoclonal SATB2 Antibody (rSATB2/6929) [Alexa Fluor 405]

Sign In for Pricing
View Details