Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C12orf28 (C12orf28)

This Recombinant Human Uncharacterized protein C12orf28 (C12orf28) spans the amino acid sequence from region 20-275.

Product Specifications

Product Name Alternative

Uncharacterized protein C12orf28

UniProt

Q96LU7

Expression Region

20-275

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DRRVPNLPPSNITSSQEPALLPTASSSAPNTSLVTTPASLQVPEITFCEILPCQETYCCP IRGMKEVSSSPVQRQSEEKEFHQRRWSEDKSKSVLARNALSGPDWESDWIDTTISSIQIM EIQQIIDHQYCIQSLQCGSGNYNYNIPVNKHTPTNVKFSLEINTTEPLIVFQCKFTLGNI CFHSKRGTKGMESHREISQEMTQGYQHIWSLPVAPFSDSMFHFRVAAPDLADCSTDPYFA GIFFTDYFFYFYRRCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDT1 antibody
70R-18987 50 μL

NUDT1 antibody

Sign In for Pricing
View Details
MEGF10 Protein Vector (Human) (pPM-C-His)
PV093765 500 ng

MEGF10 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
PRPF4 antibody
70R-19548 50 ul

PRPF4 antibody

Sign In for Pricing
View Details
Human Kruppel Like Factor 2, Lung (KLF2) ELISA Kit
orb778094-01 48 Tests

Human Kruppel Like Factor 2, Lung (KLF2) ELISA Kit

Sign In for Pricing
View Details
Human Kruppel Like Factor 2, Lung (KLF2) ELISA Kit
orb778094-02 96 Tests

Human Kruppel Like Factor 2, Lung (KLF2) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Hrg shRNA (UAS) - Lentiviral mouse Hrg shRNA (UAS) (25)
GTR15273845 1 Vial

Lentiviral mouse Hrg shRNA (UAS) - Lentiviral mouse Hrg shRNA (UAS) (25)

Sign In for Pricing
View Details