Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe UPF0644 protein PB2B4.06 (SPAPB2B4.06)

This Recombinant Schizosaccharomyces pombe UPF0644 protein PB2B4.06 (SPAPB2B4.06) spans the amino acid sequence from region 1-256.

Product Specifications

Product Name Alternative

UPF0644 protein PB2B4.06

UniProt

Q9HDW5

Expression Region

1-256

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGIASSLRLFGKAPASYLFNGFRRQMKNPLMKKGVVYAGVSGTCAAAGYMFGNFVMEKHI YQVKYTEEQEKEVLEVENRLQNLKIVKDLRQNPSFRELRMPFNRSNHSLTNNLLSGPGRI TVPPVIFYDKSTRQVYAIAHVGKDVGLDDDTIHPGLIATCMDEVLAICSFLSLPNKIAVT ANLKLSNPTKAYTNHFYILRSHLEWTKGRKAQTHGTAYMLDNEDPSKSTCVAIADGLFVE PRFAKYLKHVIPVSLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
BNC042848-100 1x 100 µL

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL
BNC740003-500 1x 500 µL

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF640R conjugate, 0.1mg/mL
BNC400152-100 1x 100 µL

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL
BNC740040-500 1x 500 µL

CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Golgi Complex (371-4), CF647 conjugate, 0.1mg/mL
BNC470102-500 1x 500 µL

Golgi Complex (371-4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details