Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 74B (TMEM74B)

This Recombinant Human Transmembrane protein 74B (TMEM74B) spans the amino acid sequence from region 1-256.

Product Specifications

Product Name Alternative

Transmembrane protein 74B

UniProt

Q9NUR3

Expression Region

1-256

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPPAQGYEFAAAKGPRDELGPSFPMASPPGLELKTLSNGPQAPRRSAPLGPVAPTREGVE NACFSSEEHETHFQNPGNTRLGSSPSPPGGVSSLPRSQRDDLSLHSEEGPALEPVSRPVD YGFVSALVFLVSGILLVVTAYAIPREARVNPDTVTAREMERLEMYYARLGSHLDRCIIAG LGLLTVGGMLLSVLLMVSLCKGELYRRRTFVPGKGSRKTYGSINLRMRQLNGDGGQALVE NEVVQVSETSHTLQRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-1ra/IL-1F3 Antibody Pair Set
E-KAB-0478 50 µL & 100 µg

Human IL-1ra/IL-1F3 Antibody Pair Set

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (UCHT1), Biotin conjugate, 0.1mg/mL
BNCB2473-100 1x 100 µL

CD3e (T-Cell Marker) (UCHT1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM40 Antibody
KC-2558-01 50 μL

TRIM40 Antibody

Sign In for Pricing
View Details
TRIM40 Antibody
KC-2558-02 100 µL

TRIM40 Antibody

Sign In for Pricing
View Details
TRIM40 Antibody
KC-2558-03 1 mL

TRIM40 Antibody

Sign In for Pricing
View Details
Tianeptine Ethyl Ester
TRC-T436830-10MG 10 mg

Tianeptine Ethyl Ester

Sign In for Pricing
View Details