Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 74B (TMEM74B)

This Recombinant Human Transmembrane protein 74B (TMEM74B) spans the amino acid sequence from region 1-256.

Product Specifications

Product Name Alternative

Transmembrane protein 74B

UniProt

Q9NUR3

Expression Region

1-256

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPPAQGYEFAAAKGPRDELGPSFPMASPPGLELKTLSNGPQAPRRSAPLGPVAPTREGVE NACFSSEEHETHFQNPGNTRLGSSPSPPGGVSSLPRSQRDDLSLHSEEGPALEPVSRPVD YGFVSALVFLVSGILLVVTAYAIPREARVNPDTVTAREMERLEMYYARLGSHLDRCIIAG LGLLTVGGMLLSVLLMVSLCKGELYRRRTFVPGKGSRKTYGSINLRMRQLNGDGGQALVE NEVVQVSETSHTLQRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apopt1 (NM_026511) Mouse Tagged ORF Clone
MG201850 10 µg

Apopt1 (NM_026511) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human FABP6/I-BABP Protein
PKSH030811 100 µg

Recombinant Human FABP6/I-BABP Protein

Sign In for Pricing
View Details
BMPR2 Human Gene Knockout Kit (CRISPR)
KN208673BN 1 Kit

BMPR2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MX1 (NM_002462) Human Over-expression Lysate
LY400886 100 µg

MX1 (NM_002462) Human Over-expression Lysate

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/1882), CF488A conjugate, 0.1mg/mL
BNC881882-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/1882), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
eIF4G1 Recombinant Rabbit Monoclonal Antibody [PSH06-28]
HA722660 100 µL

eIF4G1 Recombinant Rabbit Monoclonal Antibody [PSH06-28]

Sign In for Pricing
View Details