Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 74B (TMEM74B)

This Recombinant Human Transmembrane protein 74B (TMEM74B) spans the amino acid sequence from region 1-256.

Product Specifications

Product Name Alternative

Transmembrane protein 74B

UniProt

Q9NUR3

Expression Region

1-256

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPPAQGYEFAAAKGPRDELGPSFPMASPPGLELKTLSNGPQAPRRSAPLGPVAPTREGVE NACFSSEEHETHFQNPGNTRLGSSPSPPGGVSSLPRSQRDDLSLHSEEGPALEPVSRPVD YGFVSALVFLVSGILLVVTAYAIPREARVNPDTVTAREMERLEMYYARLGSHLDRCIIAG LGLLTVGGMLLSVLLMVSLCKGELYRRRTFVPGKGSRKTYGSINLRMRQLNGDGGQALVE NEVVQVSETSHTLQRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vitamin K2(5)
TRC-V676120-5MG 5 mg

Vitamin K2(5)

Sign In for Pricing
View Details
RAET1G Human Gene Knockout Kit (CRISPR)
KN418328 1 Kit

RAET1G Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Purified Anti-Human CD20 Antibody[2H7]
E-AB-F1212A-01 25 µg

Purified Anti-Human CD20 Antibody[2H7]

Sign In for Pricing
View Details
Purified Anti-Human CD20 Antibody[2H7]
E-AB-F1212A-02 100 µg

Purified Anti-Human CD20 Antibody[2H7]

Sign In for Pricing
View Details
GRPEL1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6G6]
TA812313BM 100 µL

GRPEL1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6G6]

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/1672), CF647 conjugate, 0.1mg/mL
BNC471672-100 1x 100 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/1672), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details