Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium fredii Nodulation protein nolT (nolT)

This Recombinant Rhizobium fredii Nodulation protein nolT (nolT) spans the amino acid sequence from region 34-289.

Product Specifications

Product Name Alternative

Nodulation protein nolT

UniProt

P33209

Expression Region

34-289

Origin

Rhizobium fredii (Sinorhizobium fredii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CKVDLYTQLQEREANEIVALLMDNGVDAVRVAGKDGTSTIQVDEKLLAFSIKLLNGKGLP RQSFKNLGEIFQGSGLIASPTEERARYVYALSEELSHTISDIDGVFSARVHVVLPHNDLL RAGDTPSSASVFIRHDAKTNLPALLPKIKMLVAESIEGLAYDKVEVVLVPVERSAQEQRS LLEPDLAQASRPIPVPLLAVAVGVGAAVFAVTCYLLFIVLGHRRRQLTGELSRVQERPGV SALAAIRKKIPALGRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Histidine--tRNA ligase (hisS)
MBS1283647-01 0.02 mg (E-Coli)

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details
Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Histidine--tRNA ligase (hisS)
MBS1283647-02 0.02 mg (Yeast)

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details
Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Histidine--tRNA ligase (hisS)
MBS1283647-03 0.1 mg (E-Coli)

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details
Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Histidine--tRNA ligase (hisS)
MBS1283647-04 0.1 mg (Yeast)

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details
Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Histidine--tRNA ligase (hisS)
MBS1283647-05 0.02 mg (Baculovirus)

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details
Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Histidine--tRNA ligase (hisS)
MBS1283647-06 0.02 mg (Mammalian-Cell)

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details