Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis RING finger protein 170 (rnf170)

This Recombinant Xenopus laevis RING finger protein 170 (rnf170) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

RING finger protein 170

UniProt

Q5PPX5

Expression Region

1-257

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADNQEERPHFPLDEGSIIEGVSDQVIVVVLLSFVAVGSLIYLLLRNDEQNIHPENQDRV RAVREQLQNEQETPAPPRPQFYSDMTCPVCLQQATFPVETNCGHLFCGSCIIAYWRYGTW LGAINCPICRQTVTLLFPLFGATDQEDAQNILQEATGYNRRFSGQPRSLMDRIMDLPTLL RHAFREMFSVGGLFWMFRIRIVLCLLGALLYLVSPLDIIPEALFGILGFLDDLFVLFLLL IYISIMYREVVTQRLYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL
BNC680151-100 1x 100 µL

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
BNC470965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
BNC740276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2424), CF647 conjugate, 0.1mg/mL
BNC472424-500 1x 500 µL

BOB.1 (B-Cell Marker) (BOB1/2424), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (MACIF/629), CF740 conjugate, 0.1mg/mL
BNC740629-500 1x 500 µL

CD59 (heavy chain of Protectin) (MACIF/629), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (C-04), CF640R conjugate, 0.1mg/mL
BNC400041-500 1x 500 µL

Cytokeratin 18 (C-04), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details