Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 55A (TMEM55A)

This Recombinant Human Transmembrane protein 55A (TMEM55A) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Transmembrane protein 55A, EC= 3.1.3.78, PtdIns-4,5-P2 4-Ptase II, Type II phosphatidylinositol 4,5-bisphosphate 4-phosphatase

UniProt

Q8N4L2

Expression Region

1-257

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAADGVDERSPLLSASHSGNVTPTAPPYLQESSPRAELPPPYTAIASPDASGIPVINCRV CQSLINLDGKLHQHVVKCTVCNEATPIKNPPTGKKYVRCPCNCLLICKDTSRRIGCPRPN CRRIINLGPVMLISEEQPAQPALPIQPEGTRVVCGHCGNTFLWMELRFNTLAKCPHCKKI SSVGSALPRRRCCAYITIGMICIFIGVGLTVGTPDFARRFRATYVSWAIAYLLGLICLIR ACYWGAIRVSYPEHSFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF766 Rabbit pAb
MBS8550151-01 0.1 mL

ZNF766 Rabbit pAb

Sign In for Pricing
View Details
ZNF766 Rabbit pAb
MBS8550151-02 0.1 mL (AF405L)

ZNF766 Rabbit pAb

Sign In for Pricing
View Details
ZNF766 Rabbit pAb
MBS8550151-03 0.1 mL (AF405S)

ZNF766 Rabbit pAb

Sign In for Pricing
View Details
ZNF766 Rabbit pAb
MBS8550151-04 0.1 mL (AF610)

ZNF766 Rabbit pAb

Sign In for Pricing
View Details
ZNF766 Rabbit pAb
MBS8550151-05 0.1 mL (AF635)

ZNF766 Rabbit pAb

Sign In for Pricing
View Details
ZNF766 Rabbit pAb
MBS8550151-06 0.1 mL (APC)

ZNF766 Rabbit pAb

Sign In for Pricing
View Details