Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 55A (Tmem55a)

This Recombinant Mouse Transmembrane protein 55A (Tmem55a) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Transmembrane protein 55A, EC= 3.1.3.78, PtdIns-4,5-P2 4-Ptase II, Type II phosphatidylinositol 4,5-bisphosphate 4-phosphatase

UniProt

Q9CZX7

Expression Region

1-257

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAADGVDERSPLLSASHSGNVTPTAPPYLQESSPRAELPPPYTAIASPGTSGIPVINCRV CQSLINLDGKLHQHVVKCTVCNEATPIKTPPTGKKYVRCPCNCLLICKDTSRRIGCPRPN CRRIINLGPVMLISEEQPAQPALPIQPEGTRVVCGHCGNTFLWMELRFNTLAKCPHCKKI SSVGSALPRRRCCAYVTIGMICIFIAVGLTVGTQDFSRRFHATYVSWAIAYLLGLICLIR ACYWGAIRVSYPEHGFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PCF11 Antibody [Alexa Fluor 647]
NBP2-12787AF647 0.1 mL

Rabbit Polyclonal PCF11 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
GOT2 Rabbit Polyclonal Antibody (HRP)
orb2120591 100 µL

GOT2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
RHOA Peptide - middle region
orb2012183 100 µg

RHOA Peptide - middle region

Sign In for Pricing
View Details
SRF (phospho Thr159) Antibody
A8427-01 50 μL

SRF (phospho Thr159) Antibody

Sign In for Pricing
View Details
SRF (phospho Thr159) Antibody
A8427-02 100 µL

SRF (phospho Thr159) Antibody

Sign In for Pricing
View Details
Olfr957 3'UTR Luciferase Stable Cell Line
TU115641 1.0 mL

Olfr957 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details